Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335398.1 | 5prime_partial | 223 | 1-672(+) |
Amino Acid sequence : | |||
RTVLRMAKDLAENNAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAALIVGSDPIVGVERPLFQMVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAF GPLGISDWNSVFWIAHPGGPAILDQVEVKLGLKPDKLKSTRHVLSEYGNMSSACVLFILDEMRKASAKEGLSTTGEGLDWGVLFGFGPGLTVETVVLHSVPLN* | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 10,508.751 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
Instability index: | 112.363 | ||
aromaticity | 0.070 | ||
GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
Helix | 0.170 | ||
turn | 0.410 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335398.1 | 3prime_partial | 218 | 654-1(-) |
Amino Acid sequence : | |||
MQHYRLHREARPKAEEHPPVEALTSGAQPFLCGSLPHLIQNKEHARARHVAVLAQHVARGLEFVGLQPQLDLHLIQYSRPTGMRYPEHRIPVRNSQRPKRLLQALFYVLGDEPRHIFQEM ECEPHFPQVAVDRPVAVGEDRLRRRHHLEQRALHPNDGVGADDERSGAVAEKGLADEAVEMTLAGAAEGDGGDLRADNQNPSAGVVLGEVLGHAEDGT | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 10,508.751 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
Instability index: | 112.363 | ||
aromaticity | 0.070 | ||
GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
Helix | 0.170 | ||
turn | 0.410 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335398.1 | 5prime_partial | 100 | 2-304(+) |
Amino Acid sequence : | |||
VPSSAWPRTSPRTTPALGFWLSALRSPPSPSAAPARVISTASSARPFSATAPLRSSSAPTPSLGWSALCSRWCRRRRRSSPTATGRSTATCGKWGSHSIS* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,508.751 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
Instability index: | 112.363 | ||
aromaticity | 0.070 | ||
GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
Helix | 0.170 | ||
turn | 0.410 | ||
sheet | 0.200 |