Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335406.1 | 5prime_partial | 149 | 760-311(-) |
Amino Acid sequence : | |||
LTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASGILGASKIIGIDVNELKREKATVFGVTEFINPKHSDKTVSQLIQEATGGLGVDWCIECTGVSSLLKEAIASPKVGIGEVVLIGAG EKEKVEIRYIPLMLGRSVKGTTLGGVRIH* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 13,446.250 | ||
Theoretical pI: | 5.785 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 68.524 | ||
aromaticity | 0.079 | ||
GRAVY | 0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.333 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335406.1 | complete | 126 | 372-752(+) |
Amino Acid sequence : | |||
MYLISTFSFSPAPINTTSPIPTFGLAMASLRREETPVHSMHQSTPNPPVASWISCDTVLSECLGFMNSVTPKTVAFSRLSSFTSIPIIFDAPRIPDALTAPSPTAPRPITATVDPFSTLD SLHGAP* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 13,446.250 | ||
Theoretical pI: | 5.785 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 68.524 | ||
aromaticity | 0.079 | ||
GRAVY | 0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.333 | ||
sheet | 0.214 |