| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335420.1 | 5prime_partial | 154 | 501-37(-) |
Amino Acid sequence : | |||
| ARGPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGAVEGYRVGGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA IVTGKGPLENLADHLADPVSNNAWAYATNFVPGK* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 16,322.417 | ||
| Theoretical pI: | 4.918 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 7.648 | ||
| aromaticity | 0.110 | ||
| GRAVY | 0.121 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.292 | ||
| sheet | 0.305 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335420.1 | 5prime_partial | 154 | 501-37(-) |
Amino Acid sequence : | |||
| ARGPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGAVEGYRVGGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA IVTGKGPLENLADHLADPVSNNAWAYATNFVPGK* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 16,322.417 | ||
| Theoretical pI: | 4.918 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 7.648 | ||
| aromaticity | 0.110 | ||
| GRAVY | 0.121 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.292 | ||
| sheet | 0.305 | ||