Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335420.1 | 5prime_partial | 154 | 501-37(-) |
Amino Acid sequence : | |||
ARGPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGAVEGYRVGGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA IVTGKGPLENLADHLADPVSNNAWAYATNFVPGK* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 16,322.417 | ||
Theoretical pI: | 4.918 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 7.648 | ||
aromaticity | 0.110 | ||
GRAVY | 0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.292 | ||
sheet | 0.305 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335420.1 | 5prime_partial | 154 | 501-37(-) |
Amino Acid sequence : | |||
ARGPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGAVEGYRVGGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA IVTGKGPLENLADHLADPVSNNAWAYATNFVPGK* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 16,322.417 | ||
Theoretical pI: | 4.918 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 7.648 | ||
aromaticity | 0.110 | ||
GRAVY | 0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.292 | ||
sheet | 0.305 |