| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335423.1 | internal | 230 | 3-692(+) |
Amino Acid sequence : | |||
| LEAKWFLDAYASRADMHPIIFELAKLEFNIAQALQQEELKDLSRWWNDTGIAEKLPFARDRIVEAHYWAIGTLEPYQYRYQRSLIAKIIALTTVVDDVYDVYGTLDELELFTDAIRRWDI ESINQLPNYMQLCYLAIYNFVCELAYDIFRDKGFNSLPYLHKSWLDLVEAYFVEAKWFHDGYTPTLEEYLNNSKITITCPAILSEIYFTFANPINKTEVESIYKYHDILY | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 27,284.704 | ||
| Theoretical pI: | 4.675 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 66810 66935 | ||
| Instability index: | 43.469 | ||
| aromaticity | 0.165 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.409 | ||
| turn | 0.139 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335423.1 | internal | 230 | 3-692(+) |
Amino Acid sequence : | |||
| LEAKWFLDAYASRADMHPIIFELAKLEFNIAQALQQEELKDLSRWWNDTGIAEKLPFARDRIVEAHYWAIGTLEPYQYRYQRSLIAKIIALTTVVDDVYDVYGTLDELELFTDAIRRWDI ESINQLPNYMQLCYLAIYNFVCELAYDIFRDKGFNSLPYLHKSWLDLVEAYFVEAKWFHDGYTPTLEEYLNNSKITITCPAILSEIYFTFANPINKTEVESIYKYHDILY | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 27,284.704 | ||
| Theoretical pI: | 4.675 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 66810 66935 | ||
| Instability index: | 43.469 | ||
| aromaticity | 0.165 | ||
| GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
| Helix | 0.409 | ||
| turn | 0.139 | ||
| sheet | 0.291 | ||