| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335431.1 | internal | 247 | 2-742(+) |
Amino Acid sequence : | |||
| HAVMLELSQWLAARGVKVTFVNSHFNHRRVVESSPEIGKMVDMVWVSDGLEKWEEISDLEKQTEGMLRVMAAEVEALITKINGNDGPKITCVIVDWLMAWAVEDAAPRIGLRTAVFCPAS AASLALTFSIPKLVADGVIDDDNGQLISKQQKIELSPDSPPINTADFYWVGMGTKLVNKNFFHFASMAHHSMNSSDWILCNSSLDLEPGILSSFPHFKPIGPLLAANRLSKSAGGFWAED STCLTWL | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 13,894.670 | ||
| Theoretical pI: | 8.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 60.005 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.285 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335431.1 | 3prime_partial | 130 | 390-1(-) |
Amino Acid sequence : | |||
| MEKVKASEAAEAGQKTAVLSPILGAASSTAHAMSQSTITHVILGPSFPFIFVIRASTSAAITLNMPSVCFSRSLISSHFSNPSETHTISTIFPISGDDSTTRRWLKWLFTNVTFTPRAAS HCESSNMTAC | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,894.670 | ||
| Theoretical pI: | 8.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 60.005 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.285 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335431.1 | internal | 247 | 2-742(+) |
Amino Acid sequence : | |||
| HAVMLELSQWLAARGVKVTFVNSHFNHRRVVESSPEIGKMVDMVWVSDGLEKWEEISDLEKQTEGMLRVMAAEVEALITKINGNDGPKITCVIVDWLMAWAVEDAAPRIGLRTAVFCPAS AASLALTFSIPKLVADGVIDDDNGQLISKQQKIELSPDSPPINTADFYWVGMGTKLVNKNFFHFASMAHHSMNSSDWILCNSSLDLEPGILSSFPHFKPIGPLLAANRLSKSAGGFWAED STCLTWL | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 13,894.670 | ||
| Theoretical pI: | 8.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 60.005 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.285 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335431.1 | 3prime_partial | 130 | 390-1(-) |
Amino Acid sequence : | |||
| MEKVKASEAAEAGQKTAVLSPILGAASSTAHAMSQSTITHVILGPSFPFIFVIRASTSAAITLNMPSVCFSRSLISSHFSNPSETHTISTIFPISGDDSTTRRWLKWLFTNVTFTPRAAS HCESSNMTAC | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,894.670 | ||
| Theoretical pI: | 8.615 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 60.005 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.285 | ||
| sheet | 0.238 | ||