| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335432.1 | 5prime_partial | 228 | 754-68(-) |
Amino Acid sequence : | |||
| ANRLSKSAGGFWAEDSTCLTWLHQHPPNSVVYAAFGSITVLDTAQFRELALGLELAGRPFLWVVRGDAAGEGCFPAGFEARVGRRGKVVGWAPQQEVLAHPSVACFISHCGWNSTVEGVS SGVPFLCWPYFADQFCNQDYICDEWKVGLRLEKDENGIVPREEVKEKIESVVGDGGYKKRASNLRARVMDGVRGGQSHANFTNFVDWIHRIQSDCEVTNSLVEGEVLR* | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 12,478.218 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 98.964 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.574 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.347 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335432.1 | complete | 168 | 128-634(+) |
Amino Acid sequence : | |||
| MDPIDEISKIRMRLSSSNTIHNSSSKIRSSLFIPSVTNNTLNFLLHFFSWHDPIFILLQSQSNLPLITNIVLITELIREIRPAQKRHPTTNSFDSRIPPTMTYKTRHRRVGQHLLLRGPP HHLPPPPHPRLEPRRKTSLSGGVPPHHPQKRPAGELEPEGELPELRRV* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 12,478.218 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 98.964 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.574 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.347 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335432.1 | 5prime_partial | 118 | 752-396(-) |
Amino Acid sequence : | |||
| QPPLQIRRRFLGGGLHVPHVAPPAPAQLRRLRRLRQHHRPRHGAVPGARPRARARRPAVSVGGAGGRRRRGMFSGGVRGEGGAAGEGGGVGPAAGGAGPPFCGVFYKSLWVEFDCRRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,478.218 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 98.964 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.574 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.347 | ||
| sheet | 0.212 | ||