Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335432.1 | 5prime_partial | 228 | 754-68(-) |
Amino Acid sequence : | |||
ANRLSKSAGGFWAEDSTCLTWLHQHPPNSVVYAAFGSITVLDTAQFRELALGLELAGRPFLWVVRGDAAGEGCFPAGFEARVGRRGKVVGWAPQQEVLAHPSVACFISHCGWNSTVEGVS SGVPFLCWPYFADQFCNQDYICDEWKVGLRLEKDENGIVPREEVKEKIESVVGDGGYKKRASNLRARVMDGVRGGQSHANFTNFVDWIHRIQSDCEVTNSLVEGEVLR* | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 12,478.218 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 98.964 | ||
aromaticity | 0.059 | ||
GRAVY | -0.574 | ||
Secondary Structure Fraction | |||
Helix | 0.203 | ||
turn | 0.347 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335432.1 | complete | 168 | 128-634(+) |
Amino Acid sequence : | |||
MDPIDEISKIRMRLSSSNTIHNSSSKIRSSLFIPSVTNNTLNFLLHFFSWHDPIFILLQSQSNLPLITNIVLITELIREIRPAQKRHPTTNSFDSRIPPTMTYKTRHRRVGQHLLLRGPP HHLPPPPHPRLEPRRKTSLSGGVPPHHPQKRPAGELEPEGELPELRRV* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 12,478.218 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 98.964 | ||
aromaticity | 0.059 | ||
GRAVY | -0.574 | ||
Secondary Structure Fraction | |||
Helix | 0.203 | ||
turn | 0.347 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335432.1 | 5prime_partial | 118 | 752-396(-) |
Amino Acid sequence : | |||
QPPLQIRRRFLGGGLHVPHVAPPAPAQLRRLRRLRQHHRPRHGAVPGARPRARARRPAVSVGGAGGRRRRGMFSGGVRGEGGAAGEGGGVGPAAGGAGPPFCGVFYKSLWVEFDCRRS* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,478.218 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 98.964 | ||
aromaticity | 0.059 | ||
GRAVY | -0.574 | ||
Secondary Structure Fraction | |||
Helix | 0.203 | ||
turn | 0.347 | ||
sheet | 0.212 |