| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335435.1 | internal | 257 | 2-772(+) |
Amino Acid sequence : | |||
| VCLPNSIKMALNLSHLTTKQSPPIQALSTFRRPPPPCMATAVAVAGNQSYWDTIQDDINSYLKKAIPIRSPETVFEPMHHLTLSAPATTASALCVAACELIGGHRSQAIAAASAIHLMHA AAHAHEHLPLTDGSRPDYKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQNQNPARILRVIIEISHAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAIL AGGADEEIEKLRNFGLC | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 17,240.471 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 101.892 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.419 | ||
Secondary Structure Fraction | |||
| Helix | 0.147 | ||
| turn | 0.327 | ||
| sheet | 0.167 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335435.1 | 5prime_partial | 150 | 1-453(+) |
Amino Acid sequence : | |||
| RLPPQFNQNGSKSLPPHHQTKSPHPSTINIPPPTAAVHGHRRRRRRESIILGHHPGRHKFVSEESHPNKIAGDGLRAHAPPHPLRPRHHRLRPLRGGLRAHRRPPEPSHRRRLRHTPHAC GGPRPRAPPPHRRLQARLQARYPTQVQPQH* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 17,240.471 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 101.892 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.419 | ||
Secondary Structure Fraction | |||
| Helix | 0.147 | ||
| turn | 0.327 | ||
| sheet | 0.167 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335435.1 | internal | 257 | 2-772(+) |
Amino Acid sequence : | |||
| VCLPNSIKMALNLSHLTTKQSPPIQALSTFRRPPPPCMATAVAVAGNQSYWDTIQDDINSYLKKAIPIRSPETVFEPMHHLTLSAPATTASALCVAACELIGGHRSQAIAAASAIHLMHA AAHAHEHLPLTDGSRPDYKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQNQNPARILRVIIEISHAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGAACGAIL AGGADEEIEKLRNFGLC | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 17,240.471 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 101.892 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.419 | ||
Secondary Structure Fraction | |||
| Helix | 0.147 | ||
| turn | 0.327 | ||
| sheet | 0.167 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335435.1 | 5prime_partial | 150 | 1-453(+) |
Amino Acid sequence : | |||
| RLPPQFNQNGSKSLPPHHQTKSPHPSTINIPPPTAAVHGHRRRRRRESIILGHHPGRHKFVSEESHPNKIAGDGLRAHAPPHPLRPRHHRLRPLRGGLRAHRRPPEPSHRRRLRHTPHAC GGPRPRAPPPHRRLQARLQARYPTQVQPQH* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 17,240.471 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 101.892 | ||
| aromaticity | 0.020 | ||
| GRAVY | -1.419 | ||
Secondary Structure Fraction | |||
| Helix | 0.147 | ||
| turn | 0.327 | ||
| sheet | 0.167 | ||