Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335441.1 | 5prime_partial | 232 | 2-700(+) |
Amino Acid sequence : | |||
SWRFNDAQLAMGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMTKFAGKDAFHLRVRVHPFHVLRINKMLSCAGADR LQTGMRGAFGKPQGVCARVAIGQVLLSVRCKDSNSPHAQEALRRAKFKFPGRQKIIVSRKWGFTKYSRSDYVRWKSENRIVSDGVNAKLLGCHGPLANRQPGRAFLTAASDE* | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 13,984.649 | ||
Theoretical pI: | 6.204 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 23.465 | ||
aromaticity | 0.079 | ||
GRAVY | -0.153 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.244 | ||
sheet | 0.213 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335441.1 | complete | 127 | 472-89(-) |
Amino Acid sequence : | |||
MRTVAIFASHREKNLPNCHTSTNTLGLAKGTSHTGLEPISTSTRQHFVYAKHMKGVNSDSQVESILSGKLCHVLVACNTSSFKCFAGDVLFLPTDQVDAEWEFVDSFLFHPHIIDPDLGI RNTTAEP* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 13,984.649 | ||
Theoretical pI: | 6.204 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 23.465 | ||
aromaticity | 0.079 | ||
GRAVY | -0.153 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.244 | ||
sheet | 0.213 |