Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335443.1 | internal | 235 | 2-706(+) |
Amino Acid sequence : | |||
TQKNVDVVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKYAHEETVATASFAGNYIVVENITEATYVCDYILGGGLDGSSSTKEAFLKKFKSAVSKGFDPDKHLEKVGIANQTTMLKGETEE IGKLVENSMMRRYGVKNINSHFISFNTICVGAQERQDATEKLIEEEVDMMIVIGGWNSSNTSSLQVITEERGIPSYWVDTPERIGPGNRIAHKLPHGELVEKEEWIPKGPVSVGI | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 26,043.140 | ||
Theoretical pI: | 5.650 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38055 | ||
Instability index: | 28.125 | ||
aromaticity | 0.077 | ||
GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.243 | ||
sheet | 0.213 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335443.1 | internal | 235 | 2-706(+) |
Amino Acid sequence : | |||
TQKNVDVVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKYAHEETVATASFAGNYIVVENITEATYVCDYILGGGLDGSSSTKEAFLKKFKSAVSKGFDPDKHLEKVGIANQTTMLKGETEE IGKLVENSMMRRYGVKNINSHFISFNTICVGAQERQDATEKLIEEEVDMMIVIGGWNSSNTSSLQVITEERGIPSYWVDTPERIGPGNRIAHKLPHGELVEKEEWIPKGPVSVGI | |||
Physicochemical properties | |||
Number of amino acids: | 235 | ||
Molecular weight: | 26,043.140 | ||
Theoretical pI: | 5.650 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38055 | ||
Instability index: | 28.125 | ||
aromaticity | 0.077 | ||
GRAVY | -0.388 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.243 | ||
sheet | 0.213 |