| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335445.1 | 5prime_partial | 145 | 702-265(-) |
Amino Acid sequence : | |||
| AAYVLSFYQFTTIKVQFFKSITSILNQCADTLSITLMIQSIEWEKRNRELILMWVKSGKQIASLIPTEKHICQALKPQLQTPQRDPLLHRAVGRSHRTCSFSTSIAPQTLLILKPHHQNL CILQLLSHSFSPKALAHYLFPGVRL* | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 13,548.117 | ||
| Theoretical pI: | 4.463 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 42.406 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.267 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.213 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335445.1 | complete | 122 | 186-554(+) |
Amino Acid sequence : | |||
| MDAGKDTEQDQLSASLNDLFSNVSGMIKGELQGTNNVLELLEKMNVRVAEEYKGFGDVASGLRVFVEQLKSKSCTFDGYVQQLDAIEDHVAEFEAVVSMLDKYVSQLESKMQSVYQISPT LK* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,548.117 | ||
| Theoretical pI: | 4.463 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 42.406 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.267 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.213 | ||
| sheet | 0.295 | ||