| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335457.1 | 5prime_partial | 196 | 2-592(+) |
Amino Acid sequence : | |||
| HAVNTNTSIINHTWVDMQIPDTVPVSPNAPDPSKPRRTKRAKEAKQAAPPRKASKPKKVKLEGDDPDMGGSSDDLNRQLGVAKPNWKEQDLGLNQVAFDELTMPPPVCSCTGVLRPCYKW GNGGWQSSCCTTNLSMYPLPAVPNKRHARVGGRKMSGGAFNKLLSRLAAEGHDLSNSVDLREHWAKHGTNRYITIK* | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 21,529.265 | ||
| Theoretical pI: | 9.624 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32220 | ||
| Instability index: | 44.440 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.767 | ||
Secondary Structure Fraction | |||
| Helix | 0.209 | ||
| turn | 0.306 | ||
| sheet | 0.204 | ||