Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335457.1 | 5prime_partial | 196 | 2-592(+) |
Amino Acid sequence : | |||
HAVNTNTSIINHTWVDMQIPDTVPVSPNAPDPSKPRRTKRAKEAKQAAPPRKASKPKKVKLEGDDPDMGGSSDDLNRQLGVAKPNWKEQDLGLNQVAFDELTMPPPVCSCTGVLRPCYKW GNGGWQSSCCTTNLSMYPLPAVPNKRHARVGGRKMSGGAFNKLLSRLAAEGHDLSNSVDLREHWAKHGTNRYITIK* | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 21,529.265 | ||
Theoretical pI: | 9.624 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32220 | ||
Instability index: | 44.440 | ||
aromaticity | 0.051 | ||
GRAVY | -0.767 | ||
Secondary Structure Fraction | |||
Helix | 0.209 | ||
turn | 0.306 | ||
sheet | 0.204 |