| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335462.1 | 3prime_partial | 221 | 90-752(+) |
Amino Acid sequence : | |||
| MVKNYPAVSEEYLKAVEKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDQCSKTGGPFGTMRFKEELAHGANNGLDIALRLLEPIRDQFPTLSFADFYQLAGVVAVEVTGGPEVPFHPGRP DKPEPPVEGRLPDATQGSDHLRQVFTKQMGLNDQDIVALSGGHTLGRCHKERSGFEGPWTTNPLIFDNSYFKELLSGEKEGLLQLPTDKTLLSDPSFRPLV | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,461.650 | ||
| Theoretical pI: | 6.314 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 35.347 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.403 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.253 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335462.1 | 3prime_partial | 221 | 90-752(+) |
Amino Acid sequence : | |||
| MVKNYPAVSEEYLKAVEKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDQCSKTGGPFGTMRFKEELAHGANNGLDIALRLLEPIRDQFPTLSFADFYQLAGVVAVEVTGGPEVPFHPGRP DKPEPPVEGRLPDATQGSDHLRQVFTKQMGLNDQDIVALSGGHTLGRCHKERSGFEGPWTTNPLIFDNSYFKELLSGEKEGLLQLPTDKTLLSDPSFRPLV | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,461.650 | ||
| Theoretical pI: | 6.314 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 35.347 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.403 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.253 | ||
| sheet | 0.276 | ||