| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335463.1 | 5prime_partial | 203 | 778-167(-) |
Amino Acid sequence : | |||
| DQCSKTGGPFGTMRFKEELAHGANNGLDIALRLLEPIRDQFPTLSFADFYQLAGVVAVEVTGGPEVPFHPGRPDKPEPPVEGRLPDATQGSDHLRQVFTKQMGLNDQDIVALSGGHTLGR CHKERSGFEGPWTTNPLIFDNSYFKELLSGEKEGLLQLPTDKTLLFDPSFRPLVEKYAADEDAFFTDYAEAHLKLSELGFADA* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 22,364.774 | ||
| Theoretical pI: | 4.803 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 30.984 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.427 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.246 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335463.1 | 5prime_partial | 203 | 778-167(-) |
Amino Acid sequence : | |||
| DQCSKTGGPFGTMRFKEELAHGANNGLDIALRLLEPIRDQFPTLSFADFYQLAGVVAVEVTGGPEVPFHPGRPDKPEPPVEGRLPDATQGSDHLRQVFTKQMGLNDQDIVALSGGHTLGR CHKERSGFEGPWTTNPLIFDNSYFKELLSGEKEGLLQLPTDKTLLFDPSFRPLVEKYAADEDAFFTDYAEAHLKLSELGFADA* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 22,364.774 | ||
| Theoretical pI: | 4.803 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 30.984 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.427 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.246 | ||
| sheet | 0.281 | ||