Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335466.1 | internal | 252 | 2-757(+) |
Amino Acid sequence : | |||
HAVGSFAMEENGMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFG VEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGVYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKK FKKIHVPEEEIV | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 11,168.830 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 54.398 | ||
aromaticity | 0.077 | ||
GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.346 | ||
sheet | 0.269 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335466.1 | complete | 104 | 438-124(-) |
Amino Acid sequence : | |||
MALLIILFLSMSASNGGNAFILSSSTPKSDGRNLLIFPATLMASKILNWSRICGNASADITTSTFFINSTSFSCSSNSPLTMMAPKDWNSSRRVVLEELGLVKT* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,168.830 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 54.398 | ||
aromaticity | 0.077 | ||
GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.346 | ||
sheet | 0.269 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335466.1 | internal | 252 | 2-757(+) |
Amino Acid sequence : | |||
HAVGSFAMEENGMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFG VEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGVYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKK FKKIHVPEEEIV | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 11,168.830 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 54.398 | ||
aromaticity | 0.077 | ||
GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.346 | ||
sheet | 0.269 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335466.1 | complete | 104 | 438-124(-) |
Amino Acid sequence : | |||
MALLIILFLSMSASNGGNAFILSSSTPKSDGRNLLIFPATLMASKILNWSRICGNASADITTSTFFINSTSFSCSSNSPLTMMAPKDWNSSRRVVLEELGLVKT* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,168.830 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 54.398 | ||
aromaticity | 0.077 | ||
GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.346 | ||
sheet | 0.269 |