Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335468.1 | 5prime_partial | 196 | 3-593(+) |
Amino Acid sequence : | |||
TRWKMASTAPKTSQVLAKLNLKPHPEGGFYSETFRDNSVILSKSNLPPHYKVDRPVSTCIYFLLPSGSFSSLHRIPCAESWHFYLGEPLTVVELNESDGSVKLTCLGPDPLAENQVVQHV VPPNVWFGAFPTADIDISSDVAVKRASKDPELHFSLVGCACAPAFQFDDFELAKRSELVSRFPKYESLITMLTFDE* | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 12,229.759 | ||
Theoretical pI: | 5.552 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 55.984 | ||
aromaticity | 0.118 | ||
GRAVY | 0.280 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.300 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335468.1 | complete | 110 | 373-705(+) |
Amino Acid sequence : | |||
MCGLVHSRLQISTSHQTLLSNEPQRIPSFISLSSDVPAPQHSSSMTLSWQSALSSSLVSLSTSLSSPCSPLMNEFRAFLTTFFVYHENCDVLVYDFGVCFATFAEIYHLF* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,229.759 | ||
Theoretical pI: | 5.552 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 55.984 | ||
aromaticity | 0.118 | ||
GRAVY | 0.280 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.300 | ||
sheet | 0.236 |