| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335472.1 | complete | 206 | 114-734(+) |
Amino Acid sequence : | |||
| MYHKRGLWAIKAKNGGKFPVHAKDVAAAVEEKAPKFYPADDVKKPLSNTRKHKPTKLRASITPGTVLIILTGRFKGKRVVFLKQLTSGLLLVTGPYKVNGVPLRRVNQAYVIGTSTKVDI SGVDVSKYDDKYFAKQVDKKKKKEEAEFFASDNAEKKNNLPAEKKDDQKAVDGPLLQAIECVPELKAYLGARFSLKAGMKPHELVF* | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 22,880.460 | ||
| Theoretical pI: | 9.871 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 30.634 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.470 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.199 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335472.1 | complete | 206 | 114-734(+) |
Amino Acid sequence : | |||
| MYHKRGLWAIKAKNGGKFPVHAKDVAAAVEEKAPKFYPADDVKKPLSNTRKHKPTKLRASITPGTVLIILTGRFKGKRVVFLKQLTSGLLLVTGPYKVNGVPLRRVNQAYVIGTSTKVDI SGVDVSKYDDKYFAKQVDKKKKKEEAEFFASDNAEKKNNLPAEKKDDQKAVDGPLLQAIECVPELKAYLGARFSLKAGMKPHELVF* | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 22,880.460 | ||
| Theoretical pI: | 9.871 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 30.634 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.470 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.199 | ||
| sheet | 0.243 | ||