| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335476.1 | internal | 249 | 2-748(+) |
Amino Acid sequence : | |||
| HAVFNTPDDKIVWDVGHQAYPHKILTGRRSRMHTIRQTFGLAGFPKRDESAHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMTAGQAYEALNNAGFLDANLIVVLNDNKQ VSLPTATVDGPAPPVGALSKALIRLQASRKFRQLREAAKGVTKQMGNQTHEIASKVDAYLKGMTGKPGTSLFEELGIYYIGPVDGHSLEDLVHIFKKVKEMPAPGPVLIHIITEKGKGYP PAEAAADKM | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 18,001.155 | ||
| Theoretical pI: | 5.207 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 13115 | ||
| Instability index: | 31.313 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.250 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335476.1 | 5prime_partial | 164 | 748-254(-) |
Amino Acid sequence : | |||
| HFISSSFSWRIAFALLGNDVNENRSRRGHLLNFLENVDKIFQRVAIYRADVINPEFLEEGGAGFPCHAFQICVHLGCDFMGLVSHLLSHAFCCFTELAEFSAGLESDEGFAQGSNRGSRA IDGGCWQGNLFVVVQDDDEIGIKKSCIVQCLVGLACCHGSISDH* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 18,001.155 | ||
| Theoretical pI: | 5.207 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 13115 | ||
| Instability index: | 31.313 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.250 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335476.1 | internal | 249 | 2-748(+) |
Amino Acid sequence : | |||
| HAVFNTPDDKIVWDVGHQAYPHKILTGRRSRMHTIRQTFGLAGFPKRDESAHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMTAGQAYEALNNAGFLDANLIVVLNDNKQ VSLPTATVDGPAPPVGALSKALIRLQASRKFRQLREAAKGVTKQMGNQTHEIASKVDAYLKGMTGKPGTSLFEELGIYYIGPVDGHSLEDLVHIFKKVKEMPAPGPVLIHIITEKGKGYP PAEAAADKM | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 18,001.155 | ||
| Theoretical pI: | 5.207 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 13115 | ||
| Instability index: | 31.313 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.250 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335476.1 | 5prime_partial | 164 | 748-254(-) |
Amino Acid sequence : | |||
| HFISSSFSWRIAFALLGNDVNENRSRRGHLLNFLENVDKIFQRVAIYRADVINPEFLEEGGAGFPCHAFQICVHLGCDFMGLVSHLLSHAFCCFTELAEFSAGLESDEGFAQGSNRGSRA IDGGCWQGNLFVVVQDDDEIGIKKSCIVQCLVGLACCHGSISDH* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 18,001.155 | ||
| Theoretical pI: | 5.207 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 13115 | ||
| Instability index: | 31.313 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.250 | ||
| sheet | 0.232 | ||