| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335478.1 | internal | 257 | 3-773(+) |
Amino Acid sequence : | |||
| RKMGRDEEAAAQAEAWNHGFGFIKTSVIKTAIELEIPDILHNQGGPLSLSALSSAVSVPLDRLHRIMRFLAHHGVSKKTASPPGESDYYYAETAVSRSLTKDNLGPFVLLQGAQRGPSAC ITAQGLKSRERPGVEELGSDPLYEDPIFTEKVFRDAMTCHARVTTSAVIENYGEGFRGVGSLVDVGGSYGMTLGMLVEAFPWIRGICYDLPPVVAKAKPLHGVEFVAGSMFESVPKADVI MLMFVWHNWSEHECIDI | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 28,062.762 | ||
| Theoretical pI: | 5.722 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32680 | ||
| Instability index: | 37.985 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.060 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.249 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335478.1 | internal | 257 | 3-773(+) |
Amino Acid sequence : | |||
| RKMGRDEEAAAQAEAWNHGFGFIKTSVIKTAIELEIPDILHNQGGPLSLSALSSAVSVPLDRLHRIMRFLAHHGVSKKTASPPGESDYYYAETAVSRSLTKDNLGPFVLLQGAQRGPSAC ITAQGLKSRERPGVEELGSDPLYEDPIFTEKVFRDAMTCHARVTTSAVIENYGEGFRGVGSLVDVGGSYGMTLGMLVEAFPWIRGICYDLPPVVAKAKPLHGVEFVAGSMFESVPKADVI MLMFVWHNWSEHECIDI | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 28,062.762 | ||
| Theoretical pI: | 5.722 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32680 | ||
| Instability index: | 37.985 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.060 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.249 | ||
| sheet | 0.276 | ||