| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335487.1 | internal | 179 | 539-3(-) |
Amino Acid sequence : | |||
| VHHEALDGGAEAEEFGELVVGAGHVDAVGGAENEVGDFGFGLPPFLDGLLRRLFPQLWHLHHHDVLPRVQRRRHVRRHVRILLQKLFRQVHVSFPYHRFLAHALEFFFEISFVLAVCNTE VVIRIGALVNAMRGRGGADCQQGGRTLGALSPADLFHRHHFCAGKRNGVFLWFDKGNRV | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 20,461.656 | ||
| Theoretical pI: | 9.557 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 43.702 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.484 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.184 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335487.1 | internal | 179 | 3-539(+) |
Amino Acid sequence : | |||
| HPISLIKPQKHTISFTGAKMVTVEEIRRAQRAEGPATLLAIGTATPSHCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVE VPKLGKEAAQKAIKEWGQPKSKITHLVFCTTNGVNMPGADYQLTKLLGLRPSVKRFMMY | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 20,461.656 | ||
| Theoretical pI: | 9.557 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 43.702 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.484 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.184 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335487.1 | internal | 179 | 539-3(-) |
Amino Acid sequence : | |||
| VHHEALDGGAEAEEFGELVVGAGHVDAVGGAENEVGDFGFGLPPFLDGLLRRLFPQLWHLHHHDVLPRVQRRRHVRRHVRILLQKLFRQVHVSFPYHRFLAHALEFFFEISFVLAVCNTE VVIRIGALVNAMRGRGGADCQQGGRTLGALSPADLFHRHHFCAGKRNGVFLWFDKGNRV | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 20,461.656 | ||
| Theoretical pI: | 9.557 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 43.702 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.484 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.184 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335487.1 | internal | 179 | 3-539(+) |
Amino Acid sequence : | |||
| HPISLIKPQKHTISFTGAKMVTVEEIRRAQRAEGPATLLAIGTATPSHCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVE VPKLGKEAAQKAIKEWGQPKSKITHLVFCTTNGVNMPGADYQLTKLLGLRPSVKRFMMY | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 20,461.656 | ||
| Theoretical pI: | 9.557 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 43.702 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.484 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.184 | ||
| sheet | 0.263 | ||