| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335491.1 | internal | 240 | 3-722(+) |
Amino Acid sequence : | |||
| WLPLPFAAFFLCVMYTWNYGSVLKYQSEVRGKIPMDLMLELGSSLGTVRTPGIGLIYNELVLGIPSVLGQFLHLPAIHSTIVFVCIKYVPVPVVPQEERFLFRRVCPKDYHMFRCIARYG YKDIRKEDHRAFEELLLESLEKFLRKEAQDLALESNVGDEADLDSISVRSRDEDGQDFDGIRELRVPLMQGERSSTSRRMQAGEELPASVMCGDEDPSVEYKLAALREASDSGFTYLLGH | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 11,573.872 | ||
| Theoretical pI: | 8.825 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 90.899 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.232 | ||
| turn | 0.446 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335491.1 | 5prime_partial | 112 | 724-386(-) |
Amino Acid sequence : | |||
| PCPSKYVNPESDASLSAASLYSTLGSSSPHITLAGSSSPACILLDVELLSPCINGTLSSRIPSKSCPSSSLDLTEMLSRSASSPTLLSRARSCASFLRNFSRLSSSSSSNAR* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 11,573.872 | ||
| Theoretical pI: | 8.825 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 90.899 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.232 | ||
| turn | 0.446 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335491.1 | internal | 240 | 3-722(+) |
Amino Acid sequence : | |||
| WLPLPFAAFFLCVMYTWNYGSVLKYQSEVRGKIPMDLMLELGSSLGTVRTPGIGLIYNELVLGIPSVLGQFLHLPAIHSTIVFVCIKYVPVPVVPQEERFLFRRVCPKDYHMFRCIARYG YKDIRKEDHRAFEELLLESLEKFLRKEAQDLALESNVGDEADLDSISVRSRDEDGQDFDGIRELRVPLMQGERSSTSRRMQAGEELPASVMCGDEDPSVEYKLAALREASDSGFTYLLGH | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 11,573.872 | ||
| Theoretical pI: | 8.825 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 90.899 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.232 | ||
| turn | 0.446 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335491.1 | 5prime_partial | 112 | 724-386(-) |
Amino Acid sequence : | |||
| PCPSKYVNPESDASLSAASLYSTLGSSSPHITLAGSSSPACILLDVELLSPCINGTLSSRIPSKSCPSSSLDLTEMLSRSASSPTLLSRARSCASFLRNFSRLSSSSSSNAR* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 11,573.872 | ||
| Theoretical pI: | 8.825 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 90.899 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.232 | ||
| turn | 0.446 | ||
| sheet | 0.259 | ||