Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335498.1 | 5prime_partial | 212 | 725-87(-) |
Amino Acid sequence : | |||
ADGPTHCGAFDTTYMACLPNMVVMAPSDEAELMHMIAPAAIMDDRPSCVRYPRGNGVGAPLPPNNKGTPLEIGKGRILKEGNRVAILGFGTIVQNCLAAAGVLEEPGISAPVADARFCKP LDGDLIKNLGKEHEILITVEEGFIGGFSAHVFHFLSLNELLDGNFKWRPMVLPDRYIEHGGPPDQIEEAGVSWKHIAATVLSLLVNEKKVFI* | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 22,822.139 | ||
Theoretical pI: | 5.333 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 38.046 | ||
aromaticity | 0.066 | ||
GRAVY | 0.051 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.264 | ||
sheet | 0.292 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335498.1 | 5prime_partial | 212 | 725-87(-) |
Amino Acid sequence : | |||
ADGPTHCGAFDTTYMACLPNMVVMAPSDEAELMHMIAPAAIMDDRPSCVRYPRGNGVGAPLPPNNKGTPLEIGKGRILKEGNRVAILGFGTIVQNCLAAAGVLEEPGISAPVADARFCKP LDGDLIKNLGKEHEILITVEEGFIGGFSAHVFHFLSLNELLDGNFKWRPMVLPDRYIEHGGPPDQIEEAGVSWKHIAATVLSLLVNEKKVFI* | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 22,822.139 | ||
Theoretical pI: | 5.333 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 38.046 | ||
aromaticity | 0.066 | ||
GRAVY | 0.051 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.264 | ||
sheet | 0.292 |