| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335504.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
| HAVTAGCGRRRWTSSLHDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQTDPLFVQATKFNSERSRLAQSFDYNYGDFIPFLRPFLKGYLAKCRDLQSRRLAFFNNYYVDKRR KIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLHQLPYLQATINETLRLHSPIPLLVPHMNQEEAT LGGYTIPKESKVVVNAWWLS | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 30,175.324 | ||
| Theoretical pI: | 8.902 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42525 | ||
| Instability index: | 62.152 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.330 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.192 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335504.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
| HAVTAGCGRRRWTSSLHDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQTDPLFVQATKFNSERSRLAQSFDYNYGDFIPFLRPFLKGYLAKCRDLQSRRLAFFNNYYVDKRR KIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLHQLPYLQATINETLRLHSPIPLLVPHMNQEEAT LGGYTIPKESKVVVNAWWLS | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 30,175.324 | ||
| Theoretical pI: | 8.902 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42525 | ||
| Instability index: | 62.152 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.330 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.192 | ||
| sheet | 0.277 | ||