| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335506.1 | internal | 259 | 2-778(+) |
Amino Acid sequence : | |||
| APGFEVIRHLEGAYALSFKSRHYPNELIACKRGSPLLLGVKDLEQNASSGSSFSDAKFPSSNGQPKELFLSSDANALVEHTKKVLVIEDGEVVHIKDGGVTIYKFDKGKNGGTLSRPASV QRALSILEMEVEQINKGKYEHYMQKEIHEQPESLTTTMRGRLIRAGSCKPKTVLLGGLKDHLKTIRRSRRIVFVGCGTSYNAALAARSIVEELSGIPVTMEIASDLVDRQGPIYREDTAV FVSQSGETADTLLALEYAL | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 28,334.995 | ||
| Theoretical pI: | 7.896 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
| Instability index: | 48.068 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.266 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.243 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335506.1 | internal | 259 | 2-778(+) |
Amino Acid sequence : | |||
| APGFEVIRHLEGAYALSFKSRHYPNELIACKRGSPLLLGVKDLEQNASSGSSFSDAKFPSSNGQPKELFLSSDANALVEHTKKVLVIEDGEVVHIKDGGVTIYKFDKGKNGGTLSRPASV QRALSILEMEVEQINKGKYEHYMQKEIHEQPESLTTTMRGRLIRAGSCKPKTVLLGGLKDHLKTIRRSRRIVFVGCGTSYNAALAARSIVEELSGIPVTMEIASDLVDRQGPIYREDTAV FVSQSGETADTLLALEYAL | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 28,334.995 | ||
| Theoretical pI: | 7.896 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
| Instability index: | 48.068 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.266 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.243 | ||
| sheet | 0.278 | ||