Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335521.1 | internal | 240 | 3-722(+) |
Amino Acid sequence : | |||
TRFCTSASLPPPPLPSTMGEIAADSAMDAVQRRLMFEDECILVDENDHVVGHESKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSTTKVTFPLVWTNTCCSHPLYRESELIEEN ALGVRNAAQRKLLDELGIPAEDVPVDQFTPLGRMLYKAPSDGIWGEHELDYLLFIVRDVEVHPNPDEVADVKYVNREELKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHVEKGTLN | |||
Physicochemical properties | |||
Number of amino acids: | 240 | ||
Molecular weight: | 27,585.111 | ||
Theoretical pI: | 4.943 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
Instability index: | 34.562 | ||
aromaticity | 0.092 | ||
GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.200 | ||
sheet | 0.313 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335521.1 | internal | 240 | 3-722(+) |
Amino Acid sequence : | |||
TRFCTSASLPPPPLPSTMGEIAADSAMDAVQRRLMFEDECILVDENDHVVGHESKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSTTKVTFPLVWTNTCCSHPLYRESELIEEN ALGVRNAAQRKLLDELGIPAEDVPVDQFTPLGRMLYKAPSDGIWGEHELDYLLFIVRDVEVHPNPDEVADVKYVNREELKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHVEKGTLN | |||
Physicochemical properties | |||
Number of amino acids: | 240 | ||
Molecular weight: | 27,585.111 | ||
Theoretical pI: | 4.943 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
Instability index: | 34.562 | ||
aromaticity | 0.092 | ||
GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.200 | ||
sheet | 0.313 |