| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335521.1 | internal | 240 | 3-722(+) |
Amino Acid sequence : | |||
| TRFCTSASLPPPPLPSTMGEIAADSAMDAVQRRLMFEDECILVDENDHVVGHESKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSTTKVTFPLVWTNTCCSHPLYRESELIEEN ALGVRNAAQRKLLDELGIPAEDVPVDQFTPLGRMLYKAPSDGIWGEHELDYLLFIVRDVEVHPNPDEVADVKYVNREELKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHVEKGTLN | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 27,585.111 | ||
| Theoretical pI: | 4.943 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
| Instability index: | 34.562 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.200 | ||
| sheet | 0.313 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335521.1 | internal | 240 | 3-722(+) |
Amino Acid sequence : | |||
| TRFCTSASLPPPPLPSTMGEIAADSAMDAVQRRLMFEDECILVDENDHVVGHESKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSTTKVTFPLVWTNTCCSHPLYRESELIEEN ALGVRNAAQRKLLDELGIPAEDVPVDQFTPLGRMLYKAPSDGIWGEHELDYLLFIVRDVEVHPNPDEVADVKYVNREELKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHVEKGTLN | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 27,585.111 | ||
| Theoretical pI: | 4.943 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
| Instability index: | 34.562 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.200 | ||
| sheet | 0.313 | ||