| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335534.1 | complete | 174 | 219-743(+) |
Amino Acid sequence : | |||
| MEVTVNQSSLTCAAGPLSLLLLVVKAHLLYTAQLHNLAKLLMASPTKDQSETVDAEGADGDESDGDGAAAGDEDGEGEYSEEGEHGNEANSNGNTKKGPGGAGEGNREDDEDDAANGHND EDDDEDDDDDDDGNEDGDDPDAAEDDDDDEDEPDDDDEEEDEEEELQPPKKKKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 16,793.260 | ||
| Theoretical pI: | 11.926 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 79.994 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.784 | ||
Secondary Structure Fraction | |||
| Helix | 0.121 | ||
| turn | 0.121 | ||
| sheet | 0.348 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335534.1 | complete | 154 | 753-289(-) |
Amino Acid sequence : | |||
| MLHFTSSSSSEAEVPPLHLPPHHHHPAHLRRRRHLPLHLGHPHLHFHRRHHHHPHRRPHHCVHWQRRLRHPLCYLHRLLPVPSWCCHCCWPRCHVHLPQNTPLLHLRLLLLHRRHRFRRH RHLQHRRFLIGPWLDSPSIVLPSYAAVLCREGEL* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 16,793.260 | ||
| Theoretical pI: | 11.926 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 79.994 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.784 | ||
Secondary Structure Fraction | |||
| Helix | 0.121 | ||
| turn | 0.121 | ||
| sheet | 0.348 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335534.1 | complete | 141 | 379-804(+) |
Amino Acid sequence : | |||
| MLKVPMATKAMATVQQQETKMEKGSILRKVNMATRPTAMATPRRDREEPVKVTERMTKTTLPMDTMMRTTMRMMMMTTMEMKMGMTQMQRKMTTTTKMSRMMMMRRKMKRRNFSLRRRRR SEVKHAADSRSNSILFLTHLQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 16,793.260 | ||
| Theoretical pI: | 11.926 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 79.994 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.784 | ||
Secondary Structure Fraction | |||
| Helix | 0.121 | ||
| turn | 0.121 | ||
| sheet | 0.348 | ||