Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335534.1 | complete | 174 | 219-743(+) |
Amino Acid sequence : | |||
MEVTVNQSSLTCAAGPLSLLLLVVKAHLLYTAQLHNLAKLLMASPTKDQSETVDAEGADGDESDGDGAAAGDEDGEGEYSEEGEHGNEANSNGNTKKGPGGAGEGNREDDEDDAANGHND EDDDEDDDDDDDGNEDGDDPDAAEDDDDDEDEPDDDDEEEDEEEELQPPKKKKK* | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 16,793.260 | ||
Theoretical pI: | 11.926 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 79.994 | ||
aromaticity | 0.014 | ||
GRAVY | -0.784 | ||
Secondary Structure Fraction | |||
Helix | 0.121 | ||
turn | 0.121 | ||
sheet | 0.348 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335534.1 | complete | 154 | 753-289(-) |
Amino Acid sequence : | |||
MLHFTSSSSSEAEVPPLHLPPHHHHPAHLRRRRHLPLHLGHPHLHFHRRHHHHPHRRPHHCVHWQRRLRHPLCYLHRLLPVPSWCCHCCWPRCHVHLPQNTPLLHLRLLLLHRRHRFRRH RHLQHRRFLIGPWLDSPSIVLPSYAAVLCREGEL* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 16,793.260 | ||
Theoretical pI: | 11.926 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 79.994 | ||
aromaticity | 0.014 | ||
GRAVY | -0.784 | ||
Secondary Structure Fraction | |||
Helix | 0.121 | ||
turn | 0.121 | ||
sheet | 0.348 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335534.1 | complete | 141 | 379-804(+) |
Amino Acid sequence : | |||
MLKVPMATKAMATVQQQETKMEKGSILRKVNMATRPTAMATPRRDREEPVKVTERMTKTTLPMDTMMRTTMRMMMMTTMEMKMGMTQMQRKMTTTTKMSRMMMMRRKMKRRNFSLRRRRR SEVKHAADSRSNSILFLTHLQ* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 16,793.260 | ||
Theoretical pI: | 11.926 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 79.994 | ||
aromaticity | 0.014 | ||
GRAVY | -0.784 | ||
Secondary Structure Fraction | |||
Helix | 0.121 | ||
turn | 0.121 | ||
sheet | 0.348 |