Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335541.1 | 5prime_partial | 258 | 1-777(+) |
Amino Acid sequence : | |||
FIGNTLWTVTFLKSLMKGAILGQAQVILMKEEFLKTYWAVRLALPYNHQTHRVTSGKMAGAEAQANQALRNWIDDATGFQGEAYGVRMRKLRRRTLLRDYWVSHMKAEFQNLGHANEPQS FTAAESTLYGNIMSDFASHAFGVLAEDGFSPATVYSSVNASYTVDYRAPVGNKTVEFSPAEVARVFKYLYQSSANPIFENMTWRQCGEAFASDIVRYFKELQPDAQSWLVKSNPVLAGNA PWVALDVTDGLDIRHLNP* | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 10,651.343 | ||
Theoretical pI: | 9.726 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 35.056 | ||
aromaticity | 0.121 | ||
GRAVY | 0.346 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.253 | ||
sheet | 0.283 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335541.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
YREYSVDCDFLEKFDEGCNFRSSTSNIDERRVFENILGCETSSTLQPSNTQSDFRENGRSRSSSESSLAQLDRRCNWVPGRSLWSENEEAKKEDTSEGLLGKPHESRVSESGSCKRATEF HGC* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 10,651.343 | ||
Theoretical pI: | 9.726 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 35.056 | ||
aromaticity | 0.121 | ||
GRAVY | 0.346 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.253 | ||
sheet | 0.283 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335541.1 | 5prime_partial | 109 | 795-466(-) |
Amino Acid sequence : | |||
CDDFLLSGVQMPYIKAISNIQSNPWCIPSQNWIGFNQPTLCIWLELFEISNNITGKGFTTLPPCHILENGICRTLVQVLKNSCNFSRTKFHRLISYRGSVINSIACIHR* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 10,651.343 | ||
Theoretical pI: | 9.726 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 35.056 | ||
aromaticity | 0.121 | ||
GRAVY | 0.346 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.253 | ||
sheet | 0.283 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335541.1 | 5prime_partial | 99 | 794-495(-) |
Amino Acid sequence : | |||
AMTFFSQGFKCLISRPSVTSKATHGAFPARTGLDLTSQLCASGWSSLKYLTISLAKASPHCLHVIFSKMGFAELWYKYLKTLATSAGLNSTVLFPTGAL* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,651.343 | ||
Theoretical pI: | 9.726 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 35.056 | ||
aromaticity | 0.121 | ||
GRAVY | 0.346 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.253 | ||
sheet | 0.283 |