| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335560.1 | 5prime_partial | 207 | 703-80(-) |
Amino Acid sequence : | |||
| ITALRRTLPPFRRCTKFELVMACVWRCRTIAISPKPNEEVQFSVLVNLRKRLNQPLPEGYYGNVFIFPPAVTAAEKLMNNSLDYAVDLVRKIKLDATEEYMRSVMDLMAIDRPNLAVARS YMVTDHTHSGLDEVDYGWGKAAYGGAATVGIHSAPGLVSFATPFKNENGEDGIVVPMSLPPDAMDLFAEELQRMLMAARKGFTASAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 22,972.385 | ||
| Theoretical pI: | 7.019 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 48.268 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.217 | ||
| sheet | 0.314 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335560.1 | 5prime_partial | 207 | 703-80(-) |
Amino Acid sequence : | |||
| ITALRRTLPPFRRCTKFELVMACVWRCRTIAISPKPNEEVQFSVLVNLRKRLNQPLPEGYYGNVFIFPPAVTAAEKLMNNSLDYAVDLVRKIKLDATEEYMRSVMDLMAIDRPNLAVARS YMVTDHTHSGLDEVDYGWGKAAYGGAATVGIHSAPGLVSFATPFKNENGEDGIVVPMSLPPDAMDLFAEELQRMLMAARKGFTASAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 22,972.385 | ||
| Theoretical pI: | 7.019 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 48.268 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.217 | ||
| sheet | 0.314 | ||