| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335561.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
| HHVFTWKSFEAERTSVFDRLIQMVGSAIEDQDSNDHMAYWLSNTSTLLFLLQKSLKPAGSAAATPAKPTSLFGRMTMGFRSSPSTVNLAAAAAALDTVRQVEAKYPALLFKQQLTAYVEK IYGIIRDNLKKELASLLALCIQAPRSSKGSVLRSGRSFGKDPSTNHWQGIIDCLNSLLSTLKENFVPPVLIQKIFTQTFSSINVQLFNSLLLRRECCTFSNGEYVKAGLAELELWCCPAK EEYAGS | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 27,222.004 | ||
| Theoretical pI: | 8.875 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31315 | ||
| Instability index: | 41.161 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.236 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335561.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
| HHVFTWKSFEAERTSVFDRLIQMVGSAIEDQDSNDHMAYWLSNTSTLLFLLQKSLKPAGSAAATPAKPTSLFGRMTMGFRSSPSTVNLAAAAAALDTVRQVEAKYPALLFKQQLTAYVEK IYGIIRDNLKKELASLLALCIQAPRSSKGSVLRSGRSFGKDPSTNHWQGIIDCLNSLLSTLKENFVPPVLIQKIFTQTFSSINVQLFNSLLLRRECCTFSNGEYVKAGLAELELWCCPAK EEYAGS | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 27,222.004 | ||
| Theoretical pI: | 8.875 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31315 | ||
| Instability index: | 41.161 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.236 | ||
| sheet | 0.293 | ||