Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335561.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
HHVFTWKSFEAERTSVFDRLIQMVGSAIEDQDSNDHMAYWLSNTSTLLFLLQKSLKPAGSAAATPAKPTSLFGRMTMGFRSSPSTVNLAAAAAALDTVRQVEAKYPALLFKQQLTAYVEK IYGIIRDNLKKELASLLALCIQAPRSSKGSVLRSGRSFGKDPSTNHWQGIIDCLNSLLSTLKENFVPPVLIQKIFTQTFSSINVQLFNSLLLRRECCTFSNGEYVKAGLAELELWCCPAK EEYAGS | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 27,222.004 | ||
Theoretical pI: | 8.875 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31315 | ||
Instability index: | 41.161 | ||
aromaticity | 0.093 | ||
GRAVY | -0.046 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.236 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335561.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
HHVFTWKSFEAERTSVFDRLIQMVGSAIEDQDSNDHMAYWLSNTSTLLFLLQKSLKPAGSAAATPAKPTSLFGRMTMGFRSSPSTVNLAAAAAALDTVRQVEAKYPALLFKQQLTAYVEK IYGIIRDNLKKELASLLALCIQAPRSSKGSVLRSGRSFGKDPSTNHWQGIIDCLNSLLSTLKENFVPPVLIQKIFTQTFSSINVQLFNSLLLRRECCTFSNGEYVKAGLAELELWCCPAK EEYAGS | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 27,222.004 | ||
Theoretical pI: | 8.875 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31315 | ||
Instability index: | 41.161 | ||
aromaticity | 0.093 | ||
GRAVY | -0.046 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.236 | ||
sheet | 0.293 |