| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335574.1 | 3prime_partial | 251 | 67-819(+) |
Amino Acid sequence : | |||
| MGNPLLDISAVVDQQFLEKYDVKLNNAILAEDKHLPMYDEMTSKFKVDYIAGGATQNSIRVAQWMLQIPGATSYMGSIGKDKYGEEMKKNAKEAGVNVHYYEDDSPTGTCAVCVLGGERS LIANLSAANCYKPDHLKKPENWALVEKAKYYYMAGFFLTVSPESMLLVAEHAIANNKVFATNLSAPFICEFFKEAQEKILPYTDFVFGNETEALTFSRVHGWETENIQEIALKISQWPKA SGTHKRITVIT | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 28,083.753 | ||
| Theoretical pI: | 5.573 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39880 40130 | ||
| Instability index: | 35.877 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.211 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335574.1 | 3prime_partial | 251 | 67-819(+) |
Amino Acid sequence : | |||
| MGNPLLDISAVVDQQFLEKYDVKLNNAILAEDKHLPMYDEMTSKFKVDYIAGGATQNSIRVAQWMLQIPGATSYMGSIGKDKYGEEMKKNAKEAGVNVHYYEDDSPTGTCAVCVLGGERS LIANLSAANCYKPDHLKKPENWALVEKAKYYYMAGFFLTVSPESMLLVAEHAIANNKVFATNLSAPFICEFFKEAQEKILPYTDFVFGNETEALTFSRVHGWETENIQEIALKISQWPKA SGTHKRITVIT | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 28,083.753 | ||
| Theoretical pI: | 5.573 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39880 40130 | ||
| Instability index: | 35.877 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.211 | ||
| sheet | 0.287 | ||