| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335577.1 | internal | 222 | 1-666(+) |
Amino Acid sequence : | |||
| CLTLLLLLSISQFTTVMASTTEPTLSRTEAEEEDDSKPAADDEDTGAQVAPIVQLQEVAVSTGEENEDVLLDLKSKLYRFDKEGNQWKERGVGIVKLLKHKETGKVRLVMRQNKTLKICA NHLVLPTMSVQEHHGNDKSCVWHAADFADGELKDETFCIRFPSVENCKAFKDKIEEIAQGQEKANGETKEGEAAANLIEKLKVADGDEEKNQSDKVEKDGEK | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 24,672.409 | ||
| Theoretical pI: | 4.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 29.476 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.654 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.171 | ||
| sheet | 0.315 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335577.1 | internal | 222 | 1-666(+) |
Amino Acid sequence : | |||
| CLTLLLLLSISQFTTVMASTTEPTLSRTEAEEEDDSKPAADDEDTGAQVAPIVQLQEVAVSTGEENEDVLLDLKSKLYRFDKEGNQWKERGVGIVKLLKHKETGKVRLVMRQNKTLKICA NHLVLPTMSVQEHHGNDKSCVWHAADFADGELKDETFCIRFPSVENCKAFKDKIEEIAQGQEKANGETKEGEAAANLIEKLKVADGDEEKNQSDKVEKDGEK | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 24,672.409 | ||
| Theoretical pI: | 4.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 29.476 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.654 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.171 | ||
| sheet | 0.315 | ||