Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335578.1 | complete | 180 | 65-607(+) |
Amino Acid sequence : | |||
MEIQGPCHTVQELAILSGLRLETANDSSFLTLENTAIEPDRLTDHTNLGPGNRPNDERPCSTTMTGLIHLNYPCLKPCHPKLKRRLLFLFLLALVLYFLAIFLYLVTLILFLVSISNLQL FDQIGCSFSFFSLSVGFLLSLSYFFDLILESFAILHRGKPNAESFILQLSISEISSVPHA* | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 11,027.871 | ||
Theoretical pI: | 4.632 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 24.571 | ||
aromaticity | 0.051 | ||
GRAVY | -1.225 | ||
Secondary Structure Fraction | |||
Helix | 0.172 | ||
turn | 0.182 | ||
sheet | 0.313 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335578.1 | 5prime_partial | 99 | 622-323(-) |
Amino Acid sequence : | |||
HGNDKSCVWHAADFADGELKDETFCIRFPSVENCKAFKDKIEEIAQGQEKANGETKEGEAAANLIEKLKVADGDEEKNQSDKVEKDGEKVENQGEKEEK* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,027.871 | ||
Theoretical pI: | 4.632 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 24.571 | ||
aromaticity | 0.051 | ||
GRAVY | -1.225 | ||
Secondary Structure Fraction | |||
Helix | 0.172 | ||
turn | 0.182 | ||
sheet | 0.313 |