| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335584.1 | 5prime_partial | 160 | 810-328(-) |
Amino Acid sequence : | |||
| HVPKGQAQNPQAQMFSDPNMAMDMMKKNLSMIIPHTLTFAWVNFFFSGFVAAKIPFPLTQRFRAMLQNGIDLSTVDVSYVSSRSWYFLNLFGLRGLFSLILGEDNATDDTQRMMQMGGFG FDPTRSLGAEKDNLDIVQPDWALPKFEQRAESALRKLVQN* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 12,653.327 | ||
| Theoretical pI: | 9.338 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 66.231 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.335 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.252 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335584.1 | complete | 111 | 180-515(+) |
Amino Acid sequence : | |||
| MRWWLNKATKHNITISQNGQPTSNTVALAKGVNHHEGHVVLQQRPCTYCFSFGRVSSMLILLAARILARPSRVGQYLDYPSLRPNSESDQIQIHPFASCAVYHQWHCPLQE* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,653.327 | ||
| Theoretical pI: | 9.338 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 66.231 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.335 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.252 | ||
| sheet | 0.207 | ||