| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335610.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
| ETEPLGTAGPLALSRDKLKDETGEPFFVLNSDVISEYPLKDMIKFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGQVEKFVQKPKLFVGNKINAGIYLLNPSVLDLIELRPTSIEKEVF PKIAAQKKLYAMVLPGFWMDIGQPKDYITGLRLYLDSLRKKSSPTLASGAHIIGNVLVDETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGVRIKKHACVSSSIIGWHSTVGQWA HVENMTILGED | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 27,377.509 | ||
| Theoretical pI: | 6.688 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 32.840 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.025 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.251 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335610.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
| ETEPLGTAGPLALSRDKLKDETGEPFFVLNSDVISEYPLKDMIKFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGQVEKFVQKPKLFVGNKINAGIYLLNPSVLDLIELRPTSIEKEVF PKIAAQKKLYAMVLPGFWMDIGQPKDYITGLRLYLDSLRKKSSPTLASGAHIIGNVLVDETAKIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGVRIKKHACVSSSIIGWHSTVGQWA HVENMTILGED | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 27,377.509 | ||
| Theoretical pI: | 6.688 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 32.840 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.025 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.251 | ||
| sheet | 0.243 | ||