Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335612.1 | 5prime_partial | 186 | 2-562(+) |
Amino Acid sequence : | |||
HAFHNHQIGALAVALPQALSPGFKAYAKQVKANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNNNAVFGDSSALAPGGVRIVFAGAPAMTSRGLVGKDF EQIAEFLHRAVSLTLKIQKEHGKLLKDFNKGLVNNKEIEELKADVEKFAASFDMPGFLVSEMKYKD* | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,112.004 | ||
Theoretical pI: | 8.809 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 35.691 | ||
aromaticity | 0.081 | ||
GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.237 | ||
sheet | 0.312 |