| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335626.1 | internal | 221 | 1-663(+) |
Amino Acid sequence : | |||
| FDWYKGPTLLEALDGIMEPKRPSDKPLRLPLQDVYKIAGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAAN FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKS | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,107.734 | ||
| Theoretical pI: | 9.045 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 31.845 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.207 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.244 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335626.1 | internal | 221 | 1-663(+) |
Amino Acid sequence : | |||
| FDWYKGPTLLEALDGIMEPKRPSDKPLRLPLQDVYKIAGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAAN FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKS | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,107.734 | ||
| Theoretical pI: | 9.045 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 31.845 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.207 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.244 | ||
| sheet | 0.240 | ||