| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335627.1 | complete | 181 | 128-673(+) |
Amino Acid sequence : | |||
| MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 14,957.005 | ||
| Theoretical pI: | 6.042 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 20.713 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.229 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.256 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335627.1 | complete | 133 | 451-50(-) |
Amino Acid sequence : | |||
| MQFIPRLNNTVPIITINHEYETLSVLEVVPPQWADLVLTPDIPHGEADVLVFNSLHIEANSRNGCNNLSKLELVQDGGLTRGIKTNHQNTHLFLGKKPAKKLRECQPHFPFLLLIPENGR FGEALERETMVSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,957.005 | ||
| Theoretical pI: | 6.042 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 20.713 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.229 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.256 | ||
| sheet | 0.278 | ||