Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335633.1 | complete | 157 | 107-580(+) |
Amino Acid sequence : | |||
MANCDMVELHKNSGNWGKVVEEIVRIEKKVFPKHESLAKSFQEEAKKRNGGLIYLLIGGEVAGYVMYSWPSSLYASITKLAVKENCRGQGHGEALLKAAIERCKTRKIHRILLHVDPLRI AAMNLYKKLGFQVDSLVESYYSSDRDAYRMYLDVAKD* | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,853.524 | ||
Theoretical pI: | 9.168 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
Instability index: | 32.883 | ||
aromaticity | 0.089 | ||
GRAVY | -0.314 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.197 | ||
sheet | 0.293 |