| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335645.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
| QLHAQAWDHALSYIKPTALSAAVELEIPDILENHGGPMTLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTTENLGPYMLMQATPVTRCPTGLSGEALKTGTSLYLK SIRGEDSWSDPAYGYHMKAFTNAMTAHARLTAAAIVRNYPAAFDGVQSVVDVGSRHGTAIGKLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILH | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 13,398.900 | ||
| Theoretical pI: | 10.206 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 54.872 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.814 | ||
Secondary Structure Fraction | |||
| Helix | 0.187 | ||
| turn | 0.285 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335645.1 | complete | 125 | 408-31(-) |
Amino Acid sequence : | |||
| MVAVGRVTPRILTSDRLQIKACPRFQGFAAQARRTPRYRRRLHQHVGPQILCREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHRAAVIFQDVGNLQLDRRRQRR GLDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,398.900 | ||
| Theoretical pI: | 10.206 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 54.872 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.814 | ||
Secondary Structure Fraction | |||
| Helix | 0.187 | ||
| turn | 0.285 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335645.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
| TSCTSMGPRPKLHQAHGAVCGGRAGDSRHPGKSRRPDDAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHDRESGALHVDAGDAGNEVSDGLERRSLENGDKPLSEV DQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,398.900 | ||
| Theoretical pI: | 10.206 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 54.872 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.814 | ||
Secondary Structure Fraction | |||
| Helix | 0.187 | ||
| turn | 0.285 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335645.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
| QLHAQAWDHALSYIKPTALSAAVELEIPDILENHGGPMTLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTTENLGPYMLMQATPVTRCPTGLSGEALKTGTSLYLK SIRGEDSWSDPAYGYHMKAFTNAMTAHARLTAAAIVRNYPAAFDGVQSVVDVGSRHGTAIGKLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILH | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 13,398.900 | ||
| Theoretical pI: | 10.206 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 54.872 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.814 | ||
Secondary Structure Fraction | |||
| Helix | 0.187 | ||
| turn | 0.285 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335645.1 | complete | 125 | 408-31(-) |
Amino Acid sequence : | |||
| MVAVGRVTPRILTSDRLQIKACPRFQGFAAQARRTPRYRRRLHQHVGPQILCREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHRAAVIFQDVGNLQLDRRRQRR GLDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,398.900 | ||
| Theoretical pI: | 10.206 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 54.872 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.814 | ||
Secondary Structure Fraction | |||
| Helix | 0.187 | ||
| turn | 0.285 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335645.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
| TSCTSMGPRPKLHQAHGAVCGGRAGDSRHPGKSRRPDDAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHDRESGALHVDAGDAGNEVSDGLERRSLENGDKPLSEV DQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,398.900 | ||
| Theoretical pI: | 10.206 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 54.872 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.814 | ||
Secondary Structure Fraction | |||
| Helix | 0.187 | ||
| turn | 0.285 | ||
| sheet | 0.268 | ||