Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335645.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
QLHAQAWDHALSYIKPTALSAAVELEIPDILENHGGPMTLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTTENLGPYMLMQATPVTRCPTGLSGEALKTGTSLYLK SIRGEDSWSDPAYGYHMKAFTNAMTAHARLTAAAIVRNYPAAFDGVQSVVDVGSRHGTAIGKLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILH | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 13,398.900 | ||
Theoretical pI: | 10.206 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 54.872 | ||
aromaticity | 0.016 | ||
GRAVY | -0.814 | ||
Secondary Structure Fraction | |||
Helix | 0.187 | ||
turn | 0.285 | ||
sheet | 0.268 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335645.1 | complete | 125 | 408-31(-) |
Amino Acid sequence : | |||
MVAVGRVTPRILTSDRLQIKACPRFQGFAAQARRTPRYRRRLHQHVGPQILCREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHRAAVIFQDVGNLQLDRRRQRR GLDVT* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 13,398.900 | ||
Theoretical pI: | 10.206 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 54.872 | ||
aromaticity | 0.016 | ||
GRAVY | -0.814 | ||
Secondary Structure Fraction | |||
Helix | 0.187 | ||
turn | 0.285 | ||
sheet | 0.268 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335645.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
TSCTSMGPRPKLHQAHGAVCGGRAGDSRHPGKSRRPDDAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHDRESGALHVDAGDAGNEVSDGLERRSLENGDKPLSEV DQR* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,398.900 | ||
Theoretical pI: | 10.206 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 54.872 | ||
aromaticity | 0.016 | ||
GRAVY | -0.814 | ||
Secondary Structure Fraction | |||
Helix | 0.187 | ||
turn | 0.285 | ||
sheet | 0.268 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335645.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
QLHAQAWDHALSYIKPTALSAAVELEIPDILENHGGPMTLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTTENLGPYMLMQATPVTRCPTGLSGEALKTGTSLYLK SIRGEDSWSDPAYGYHMKAFTNAMTAHARLTAAAIVRNYPAAFDGVQSVVDVGSRHGTAIGKLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILH | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 13,398.900 | ||
Theoretical pI: | 10.206 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 54.872 | ||
aromaticity | 0.016 | ||
GRAVY | -0.814 | ||
Secondary Structure Fraction | |||
Helix | 0.187 | ||
turn | 0.285 | ||
sheet | 0.268 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335645.1 | complete | 125 | 408-31(-) |
Amino Acid sequence : | |||
MVAVGRVTPRILTSDRLQIKACPRFQGFAAQARRTPRYRRRLHQHVGPQILCREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHRAAVIFQDVGNLQLDRRRQRR GLDVT* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 13,398.900 | ||
Theoretical pI: | 10.206 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 54.872 | ||
aromaticity | 0.016 | ||
GRAVY | -0.814 | ||
Secondary Structure Fraction | |||
Helix | 0.187 | ||
turn | 0.285 | ||
sheet | 0.268 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335645.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
TSCTSMGPRPKLHQAHGAVCGGRAGDSRHPGKSRRPDDAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHDRESGALHVDAGDAGNEVSDGLERRSLENGDKPLSEV DQR* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,398.900 | ||
Theoretical pI: | 10.206 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 54.872 | ||
aromaticity | 0.016 | ||
GRAVY | -0.814 | ||
Secondary Structure Fraction | |||
Helix | 0.187 | ||
turn | 0.285 | ||
sheet | 0.268 |