| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335646.1 | 5prime_partial | 237 | 854-141(-) |
Amino Acid sequence : | |||
| LMQATPVTRCPTGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMTAHARLTAAAIVRNYPAAFDGVQSVVDVGSRHGTAIGKLVEAFPWVRGIAFDLPEIVADAPPRKGVDF VGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAIPANIGKVMIVDAIINEDGEGDEFSGTRLSLDMIMLAVMAQGKERTYKEWVHLLNEAGFSKHTVKNIKAMEFVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 18,788.272 | ||
| Theoretical pI: | 11.687 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 79.029 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.733 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.209 | ||
| sheet | 0.131 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335646.1 | complete | 153 | 222-683(+) |
Amino Acid sequence : | |||
| MHPFLISSLLSLRHHRQHYHIQRQTSTRKLIPFSIFVNYSIYNHHFADIRWNRFFTFLQNFYAFIVAPIMQYPHEHDCVSFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRERLH QFPNSRSVTAAHIHHRLHSVKRRRIVSYNGRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 18,788.272 | ||
| Theoretical pI: | 11.687 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 79.029 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.733 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.209 | ||
| sheet | 0.131 | ||