| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335656.1 | 3prime_partial | 201 | 138-740(+) |
Amino Acid sequence : | |||
| MVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGK TQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLT | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 21,989.836 | ||
| Theoretical pI: | 5.965 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 27.070 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.340 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.209 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335656.1 | 3prime_partial | 201 | 138-740(+) |
Amino Acid sequence : | |||
| MVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGK TQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLT | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 21,989.836 | ||
| Theoretical pI: | 5.965 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 27.070 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.340 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.209 | ||
| sheet | 0.204 | ||