| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335661.1 | internal | 264 | 3-794(+) |
Amino Acid sequence : | |||
| TRYLLSFSSADLAFILMAKIKIGINGFGRIGRLVARVALLSDDVELVAVNDPFITTEYMTYMFKYDTVHGQWKKHELTVKDSKTLLFGDKPVTVFGVRNPEEIPWAEAGADYVVESTGVF TDQDKAAAHIKGGAKKVVISAPSKDAPMFVMGVNEKEYKKEINIVSNASCTTNCLAPLAKVLNDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSNTGAAKAVGKVLP ALNGKLTGMAFRVPTVDVSVVDLT | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 14,823.358 | ||
| Theoretical pI: | 8.007 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 40.913 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.757 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.255 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335661.1 | 5prime_partial | 141 | 793-368(-) |
Amino Acid sequence : | |||
| VRSTTETSTVGTRKAIPVSFPLRAGSTFPTALAAPVLLGIILNEAALPPLQSFIEGPSTVFCVAVMEWTVVINPSTIPNLSLRTLAKGARQLVVQLALETMLISFLYSFSLTPITNIGAS LLGAEMTTFLAPPFMCAAALS* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 14,823.358 | ||
| Theoretical pI: | 8.007 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 40.913 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.757 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.255 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335661.1 | internal | 264 | 3-794(+) |
Amino Acid sequence : | |||
| TRYLLSFSSADLAFILMAKIKIGINGFGRIGRLVARVALLSDDVELVAVNDPFITTEYMTYMFKYDTVHGQWKKHELTVKDSKTLLFGDKPVTVFGVRNPEEIPWAEAGADYVVESTGVF TDQDKAAAHIKGGAKKVVISAPSKDAPMFVMGVNEKEYKKEINIVSNASCTTNCLAPLAKVLNDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSNTGAAKAVGKVLP ALNGKLTGMAFRVPTVDVSVVDLT | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 14,823.358 | ||
| Theoretical pI: | 8.007 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 40.913 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.757 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.255 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335661.1 | 5prime_partial | 141 | 793-368(-) |
Amino Acid sequence : | |||
| VRSTTETSTVGTRKAIPVSFPLRAGSTFPTALAAPVLLGIILNEAALPPLQSFIEGPSTVFCVAVMEWTVVINPSTIPNLSLRTLAKGARQLVVQLALETMLISFLYSFSLTPITNIGAS LLGAEMTTFLAPPFMCAAALS* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 14,823.358 | ||
| Theoretical pI: | 8.007 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 40.913 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.757 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.255 | ||
| sheet | 0.333 | ||