| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335665.1 | internal | 241 | 2-724(+) |
Amino Acid sequence : | |||
| HPLSVVLINPTTKLPHSICAKDVHGGRRSKSILSSRANFSVSAILTQTKDSSTSPQFDIKKYMVEKANSVNRALEAAIQLKEPVEIHESMRYSLLAGGKRVRPILCITACELVGGEESTA MPAACAVEMIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSAEGMAAVGLDHLELIHPPEERRRW C | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 16,301.539 | ||
| Theoretical pI: | 7.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
| Instability index: | 61.661 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.259 | ||
| sheet | 0.286 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335665.1 | 5prime_partial | 190 | 724-152(-) |
Amino Acid sequence : | |||
| APAPPFFRRVDQLQMIESHGRHPLRADVHHLPPRQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVPGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHGLDHLDGAGRR HGRGFLATDQLTGRDAEDRPHSLAASEKGIPHGLVDLYWLLQLDCCFQGSVHGIRLLHHVFLDIELRRSR* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 16,301.539 | ||
| Theoretical pI: | 7.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
| Instability index: | 61.661 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.259 | ||
| sheet | 0.286 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335665.1 | complete | 147 | 513-70(-) |
Amino Acid sequence : | |||
| MASPASTAAFSPNTLWLVGFPRRRSSLSMQGRSSCIKDMVWIISTAQAAGMAVDSSPPTSSQAVMQRIGRTLLPPARREYLMDSWISTGSFSWIAASKALFTEFAFSTMYFLISNCGEVD ESLVWVRIAETEKLARDERIDLDLRPP* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,301.539 | ||
| Theoretical pI: | 7.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
| Instability index: | 61.661 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.259 | ||
| sheet | 0.286 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335665.1 | internal | 241 | 2-724(+) |
Amino Acid sequence : | |||
| HPLSVVLINPTTKLPHSICAKDVHGGRRSKSILSSRANFSVSAILTQTKDSSTSPQFDIKKYMVEKANSVNRALEAAIQLKEPVEIHESMRYSLLAGGKRVRPILCITACELVGGEESTA MPAACAVEMIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSAEGMAAVGLDHLELIHPPEERRRW C | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 16,301.539 | ||
| Theoretical pI: | 7.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
| Instability index: | 61.661 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.259 | ||
| sheet | 0.286 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335665.1 | 5prime_partial | 190 | 724-152(-) |
Amino Acid sequence : | |||
| APAPPFFRRVDQLQMIESHGRHPLRADVHHLPPRQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVPGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHGLDHLDGAGRR HGRGFLATDQLTGRDAEDRPHSLAASEKGIPHGLVDLYWLLQLDCCFQGSVHGIRLLHHVFLDIELRRSR* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 16,301.539 | ||
| Theoretical pI: | 7.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
| Instability index: | 61.661 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.259 | ||
| sheet | 0.286 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335665.1 | complete | 147 | 513-70(-) |
Amino Acid sequence : | |||
| MASPASTAAFSPNTLWLVGFPRRRSSLSMQGRSSCIKDMVWIISTAQAAGMAVDSSPPTSSQAVMQRIGRTLLPPARREYLMDSWISTGSFSWIAASKALFTEFAFSTMYFLISNCGEVD ESLVWVRIAETEKLARDERIDLDLRPP* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,301.539 | ||
| Theoretical pI: | 7.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
| Instability index: | 61.661 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.259 | ||
| sheet | 0.286 | ||