| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335667.1 | 5prime_partial | 106 | 728-408(-) |
Amino Acid sequence : | |||
| LETTALFDVLPFRRVWPFSESGCTSLEEGTSSDVLCLDCSPCRPVLVAFLLEKASTAPENLSRRSCPTDILPGLSIEGPAPLLPVGFLGLELEPICGYFNIVQSNT* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 10,908.711 | ||
| Theoretical pI: | 11.282 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.823 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.139 | ||
| turn | 0.396 | ||
| sheet | 0.119 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335667.1 | 5prime_partial | 102 | 1-309(+) |
Amino Acid sequence : | |||
| ARGLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDKISEKKMLTPIEVLCKSYPSEFISYFHYCRSLRFEDKPDYSYLKRLFRDLFIREGNEYSNCMLPLISC* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,908.711 | ||
| Theoretical pI: | 11.282 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.823 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.139 | ||
| turn | 0.396 | ||
| sheet | 0.119 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335667.1 | 3prime_partial | 101 | 427-729(+) |
Amino Acid sequence : | |||
| MLKYPQIGSSSRPRNPTGNNGAGPSIDRPGRISVGQDLRDRFSGAVEAFSRRNATSTGRHGEQSRHRTSEDVPSSKDVQPDSEKGQTRRNGSTSKRAVVSS | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,908.711 | ||
| Theoretical pI: | 11.282 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.823 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.139 | ||
| turn | 0.396 | ||
| sheet | 0.119 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335667.1 | 5prime_partial | 106 | 728-408(-) |
Amino Acid sequence : | |||
| LETTALFDVLPFRRVWPFSESGCTSLEEGTSSDVLCLDCSPCRPVLVAFLLEKASTAPENLSRRSCPTDILPGLSIEGPAPLLPVGFLGLELEPICGYFNIVQSNT* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 10,908.711 | ||
| Theoretical pI: | 11.282 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.823 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.139 | ||
| turn | 0.396 | ||
| sheet | 0.119 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335667.1 | 5prime_partial | 102 | 1-309(+) |
Amino Acid sequence : | |||
| ARGLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDKISEKKMLTPIEVLCKSYPSEFISYFHYCRSLRFEDKPDYSYLKRLFRDLFIREGNEYSNCMLPLISC* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,908.711 | ||
| Theoretical pI: | 11.282 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.823 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.139 | ||
| turn | 0.396 | ||
| sheet | 0.119 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335667.1 | 3prime_partial | 101 | 427-729(+) |
Amino Acid sequence : | |||
| MLKYPQIGSSSRPRNPTGNNGAGPSIDRPGRISVGQDLRDRFSGAVEAFSRRNATSTGRHGEQSRHRTSEDVPSSKDVQPDSEKGQTRRNGSTSKRAVVSS | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,908.711 | ||
| Theoretical pI: | 11.282 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.823 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.139 | ||
| turn | 0.396 | ||
| sheet | 0.119 | ||