| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335671.1 | 5prime_partial | 171 | 2-517(+) |
Amino Acid sequence : | |||
| VSGLLTIGPRFGGAVDDAARYFKDAYDRGLTPYEFVESMKKRGIRVPGIGHRIKRGDNRDKRVELLQLYARENFPSVKYMEYAVQVETYTLSKANNLVLNVDGAIGSLFLDLLAGSGMFT KPEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK* | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 19,374.054 | ||
| Theoretical pI: | 9.026 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20400 | ||
| Instability index: | 28.668 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.216 | ||
| sheet | 0.251 | ||