Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335675.1 | 5prime_partial | 143 | 2-433(+) |
Amino Acid sequence : | |||
HHVLVPLWGRQIPYTTMKFASFETIVELLYKHAIPTPKNECSKSLQLGVSFAGGYIAGVFCAIVSHPADNLVSFLNNAKGATVGDAVKKLGLWGLFTRGLPLRIVMIGTLTGAQWGIYDA FKVFVGLPTTGGPAPVAPEAAKA* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,194.637 | ||
Theoretical pI: | 9.394 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 21.941 | ||
aromaticity | 0.105 | ||
GRAVY | 0.385 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.252 | ||
sheet | 0.259 |