| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335677.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| KISHPFSEMASPREENVYMAKLAEQAERYEEMVEFMEKVVCAVDAEELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNESHVSSIKTYRSKIEAELCSICDGILKLLDTKLI GSASNGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLT LWTSDMXDDNS | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 14,408.020 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 124.842 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.899 | ||
Secondary Structure Fraction | |||
| Helix | 0.152 | ||
| turn | 0.432 | ||
| sheet | 0.159 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335677.1 | 5prime_partial | 132 | 2-400(+) |
Amino Acid sequence : | |||
| KSLILSLKWRPHERRTCTWPSSRSRPSATRRWSSSWRRSSVPSTLRNSPWRSATSSPSPIRTSSAPVAPPGGSSPPLSRRKKAAATRAMSPPSKPTDLRSRRSSALFATAFSSYSTPSSS DPPPTATPRFST* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,408.020 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 124.842 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.899 | ||
Secondary Structure Fraction | |||
| Helix | 0.152 | ||
| turn | 0.432 | ||
| sheet | 0.159 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335677.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| KISHPFSEMASPREENVYMAKLAEQAERYEEMVEFMEKVVCAVDAEELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNESHVSSIKTYRSKIEAELCSICDGILKLLDTKLI GSASNGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLT LWTSDMXDDNS | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 14,408.020 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 124.842 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.899 | ||
Secondary Structure Fraction | |||
| Helix | 0.152 | ||
| turn | 0.432 | ||
| sheet | 0.159 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335677.1 | 5prime_partial | 132 | 2-400(+) |
Amino Acid sequence : | |||
| KSLILSLKWRPHERRTCTWPSSRSRPSATRRWSSSWRRSSVPSTLRNSPWRSATSSPSPIRTSSAPVAPPGGSSPPLSRRKKAAATRAMSPPSKPTDLRSRRSSALFATAFSSYSTPSSS DPPPTATPRFST* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,408.020 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 124.842 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.899 | ||
Secondary Structure Fraction | |||
| Helix | 0.152 | ||
| turn | 0.432 | ||
| sheet | 0.159 | ||