| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335687.1 | 3prime_partial | 254 | 52-813(+) |
Amino Acid sequence : | |||
| MASCGALRTTFLPSLLHSHRTTAALPTKTQKFSVGAALQHDNTNDISSVASQESKPLTFTGEKPSTPILDTINFPNHMKNLSIQELEKLCDELREEIVYTVSKTGGHLSSSLGVSELTVA LHHVFNTPDDKIVWDVGHQAYPHKILTGRRSRMHTIRQTFGLAGFPKRDESAHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMTAGQAYEALNNAGFLDANLIVVLNDNK QVSLPTATVDGPAP | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 27,186.307 | ||
| Theoretical pI: | 6.484 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 36.765 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.215 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.272 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335687.1 | 3prime_partial | 254 | 52-813(+) |
Amino Acid sequence : | |||
| MASCGALRTTFLPSLLHSHRTTAALPTKTQKFSVGAALQHDNTNDISSVASQESKPLTFTGEKPSTPILDTINFPNHMKNLSIQELEKLCDELREEIVYTVSKTGGHLSSSLGVSELTVA LHHVFNTPDDKIVWDVGHQAYPHKILTGRRSRMHTIRQTFGLAGFPKRDESAHDAFGAGHSSTSISAGLGMAVGRDLLNKNNHVISVIGDGAMTAGQAYEALNNAGFLDANLIVVLNDNK QVSLPTATVDGPAP | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 27,186.307 | ||
| Theoretical pI: | 6.484 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 36.765 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.215 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.272 | ||
| sheet | 0.252 | ||