Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335696.1	complete	204	54-668(+)
Amino Acid sequence :
MSGYMSRLFPRSNSSFFLQSGNALNAKVVRVREDTYLVDSGIGRPRTAMPNELINPPKSDGAAAFSSKVGFLNPVRGESTVRSSFLQRYFVDLVTGDERTKQLAAARFDDAVGQTDAARG GDQPLLLPRRFRKQRAWAELKNRHKYSRKVKGFIAGKVRGGYTVGIAGYVAFLSGRNVLNGRIDSDRFVIESFSPKDIVVSKVG*
Physicochemical properties
Number of amino acids:		204
Molecular weight:		16,281.545
Theoretical pI:		10.163
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		63.039
aromaticity		0.034
GRAVY		-0.700
Secondary Structure Fraction
Helix		0.248
turn		0.297
sheet		0.214

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335696.1	5prime_partial	145	797-360(-)
Amino Acid sequence :
HHSCSGIIKHQIKQNRDVKLNCRTKTKIIPRNRESFSKFEPKQSPNFRDNNILGAEALDHEPVAVNPPIQNIPTRKKRNVAGDPHRVASPHFPGDETLHLPAILMPILQLRPRPLLPESP RQEERLIAAASGVGLPYRVVEPRGG*
Physicochemical properties
Number of amino acids:		145
Molecular weight:		16,281.545
Theoretical pI:		10.163
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1615
Instability index:		63.039
aromaticity		0.034
GRAVY		-0.700
Secondary Structure Fraction
Helix		0.248
turn		0.297
sheet		0.214