Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335700.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
TPYKVSIRKTVLFVQLWIMLNVSPSIAWCRFPAFSKLQLPLQTIGPEASAFDRKGGGPYTGIADGRIVKYQGPRVGFTDFAVTSPNRTKAKCDGKNGPELQQICGRPFGLGFYYKTGDLY ITDAFYGLVVVGPNGGLVTRVPGFQGRNFAFLDALDIDQSKGVVYFVDSGAIFLTGNRTRIVESGDTSGRLFKYDIATKQVTLILSGLSGPVGVALSKDNSYVLITEYIAQRIRRFWIKG AKANS | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 26,786.536 | ||
Theoretical pI: | 9.751 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 33015 | ||
Instability index: | 28.675 | ||
aromaticity | 0.122 | ||
GRAVY | -0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.265 | ||
sheet | 0.167 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335700.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
TPYKVSIRKTVLFVQLWIMLNVSPSIAWCRFPAFSKLQLPLQTIGPEASAFDRKGGGPYTGIADGRIVKYQGPRVGFTDFAVTSPNRTKAKCDGKNGPELQQICGRPFGLGFYYKTGDLY ITDAFYGLVVVGPNGGLVTRVPGFQGRNFAFLDALDIDQSKGVVYFVDSGAIFLTGNRTRIVESGDTSGRLFKYDIATKQVTLILSGLSGPVGVALSKDNSYVLITEYIAQRIRRFWIKG AKANS | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 26,786.536 | ||
Theoretical pI: | 9.751 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 33015 | ||
Instability index: | 28.675 | ||
aromaticity | 0.122 | ||
GRAVY | -0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.265 | ||
sheet | 0.167 |