| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335704.1 | complete | 149 | 490-41(-) |
Amino Acid sequence : | |||
| MKVALVSAGYLMVATTFLAGINRITRQDFDWIMNRPPILQAFEILTRLMDDLAGHGKEEKIAAVSCYMKEYGCSEMEASRELWKQVKKAWKDLNDGWMEPRAASSEILACIIDQSGISNN LYSTGEDGFSDSTTRTKQFIKSLLVDRIN* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,821.146 | ||
| Theoretical pI: | 5.465 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 44.799 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.217 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.201 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335704.1 | complete | 149 | 490-41(-) |
Amino Acid sequence : | |||
| MKVALVSAGYLMVATTFLAGINRITRQDFDWIMNRPPILQAFEILTRLMDDLAGHGKEEKIAAVSCYMKEYGCSEMEASRELWKQVKKAWKDLNDGWMEPRAASSEILACIIDQSGISNN LYSTGEDGFSDSTTRTKQFIKSLLVDRIN* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,821.146 | ||
| Theoretical pI: | 5.465 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 44.799 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.217 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.201 | ||
| sheet | 0.289 | ||